PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04922g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 414aa    MW: 45489.6 Da    PI: 5.9917
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04922g00002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.84.9e-0891153163
                               XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                               e+e kr  r   NRe+Ar   +R++a  eeL++k++ L  eN+ Lkk+ e   ke++ lk+e+
  Niben101Scf04922g00002.1  91 EREEKRLCRVLANRESARQTIRRRQAMYEELTRKAADLALENENLKKTKELAAKEYEPLKNEN 153
                               7899********************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.1E-691155IPR004827Basic-leucine zipper domain
PfamPF001705.7E-791153IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.46193156IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.72E-595151No hitNo description
CDDcd147023.83E-1296146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MNINTKQVEE SPRPWTAEKG RVSGGGDRED EVVGCELEAA QALACLAGRS QEQPIAMPDE  60
QESELKTSPR HALNYPLVVS RRSRQNLTEE EREEKRLCRV LANRESARQT IRRRQAMYEE  120
LTRKAADLAL ENENLKKTKE LAAKEYEPLK NENTNLRIQE TDGGSKSKPV EISTTITAAT  180
PNPTTNPIPA PLFNQSLITP FFWPSIVQPF SAFLLQCGSQ HISDIASVLP SPTSGELNSI  240
NRQESSNPGN PLFVLPVPCL IPFHPQSSSP FLPWSSTLTD KHHAETSSVH QCSTSYLNTG  300
NNQAAIAAER DAPESVKAKR RDFLHEAELR FPPEGGASEG SRQPSSSHIQ LGTSEHINAS  360
DIGAISCTVG HLEDTSEKIS QECITSSSKN PVDPQAAAEA RKRRKDMHQD ACTG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1400405RKRRKD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009798218.10.0PREDICTED: uncharacterized protein LOC104244482
TrEMBLK4CR051e-112K4CR05_SOLLC; Uncharacterized protein
STRINGSolyc09g009760.1.11e-112(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-22bZIP family protein